diff --git a/ostrapy/Day1/Basic_data_types_EXERCISES.ipynb b/ostrapy/Day1/Basic_data_types_EXERCISES.ipynb
index cfdd038..ed5a387 100644
--- a/ostrapy/Day1/Basic_data_types_EXERCISES.ipynb
+++ b/ostrapy/Day1/Basic_data_types_EXERCISES.ipynb
@@ -11,7 +11,7 @@
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**1: Assign the partial human insulin sequence below to the variable \"insulin\":**\n",
+    "**1: Aşagıda bir kısmı verilen insülin dizisini insülin değişkenine atayınız \"insulin\":**\n",
     "**'MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLA'**"
    ]
   },
@@ -19,105 +19,105 @@
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**2: How long is this partial sequence?**"
+    "**2: Bu dizinin uzunluğu ne kadar?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**3: How many Leucines are in this sequence?**"
+    "**3: Dizi de kaç adet L(Leucine) bulunmaktadır?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**4: What is the start position of 'PAAAF' in insulin?**"
+    "**4: 'PAAAF' ın insulin içindeki başlangıç pozisyonu nedir?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**5: Is 'LLLL' sequence in insulin?**"
+    "**5: 'LLLL' dizisi insülin değişkeni içerisinde mi?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**6: Print first amino acid from insulin**"
+    "**6: İnsülin içerisindeki ilk amino acidi yazdırınız -Print**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**7: Print first six amino acids from insulin**"
+    "**7: İnsülin içerisindeki ilk 6 amino acidi yazdırınız -Print**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**8: Print last amino acid from insulin**"
+    "**8: İnsülin içerisindeki son amino acidi yazdırınız- Print**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**9: Replace all Leucines with 'X'**"
+    "**9: Tüm 'L' olan harfleri 'X' ile degiştiriniz -Replace**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**10: Make insulin lowercase**"
+    "**10: İnsülin dizisini küçük harfe dönüştürünüz**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "# List"
+    "# Listeler"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**1: Make a list named ncbi_list from  NCBI numbers: NP_001191615.1, NP_571131.1, XP_014388588.1, XP_011213888.1**"
+    "**1: NP_001191615.1, NP_571131.1, XP_014388588.1, XP_011213888.1 degişkenlerini barındıran ncbi_list isimli bir liste oluşturunuz**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**2: How long is your list? (Please let Python to count it :D )**"
+    "**2: Bu listenin uzunluğu ne kadar ?(Lütfen bunu pythonun bulmasına izin verin :D )**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**3: Is NP_571231.1 in ncbi_list ?**"
+    "**3: Oluşturduğumuz listenin içerisinde NP_571231.1 ögesi var mı?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**4: Print first item from ncbi_list**"
+    "**4: ncbi_list isimli listenin ilk ögesini yazdırınız**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**5: Add 'NP_571131.1' to ncbi_list and print ncbi_list.**"
+    "**5:'NP_571131.1' ögesini ncbi_list isimli listeye ekleyiniz.**"
    ]
   },
   {
@@ -131,77 +131,77 @@
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**1:Prepare set named ncbi_set from NCBI numbers:  NP_001191615.1, NP_571131.1, NP_001191615.1, XP_011213888.1, NP_001191615.1**"
+    "**1:NP_001191615.1, NP_571131.1, NP_001191615.1, XP_011213888.1, NP_001191615.1 ögelerinden oluşan ncbi_set isimli bir küme oluşturunuz**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**2: How long is this set?**"
+    "**2: Bu kümenin uzunlugu ne kadar?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**3: Prepare a list named ncbi_ls from NP_001191615.1, NP_571131.1, NP_001191615.1, XP_011213888.1, NP_001191615.1 and then make a set named ncbi_set from that list.**\n"
+    "**3: NP_001191615.1, NP_571131.1, NP_001191615.1, XP_011213888.1, NP_001191615.1 ögelerinden oluşan ncbi_ls isimli bir liste oluşturup bu listeyi ncbi_set isimli kümeye dönüştürünüz.**\n"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**4:Add 'XP_004317908.1' to ncbi_set.**"
+    "**4:'XP_004317908.1' ögesini ncbi_set isimli kümeye ekleyiniz.**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "# Dictionary"
+    "# Sözlükler"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**1: Prepare a dictionary codon_dict from few codons and corresponding amino acids: TGG: W, ATG: M, GAT: D, GAC: D** "
+    "**1: codon_dict isimli bir sözlük oluşturup verilen kodonları ve karşılık geldikleri amino acidleri sözlük yapısında oluşturunuz,amino acidler: TGG: W, ATG: M, GAT: D, GAC: D** "
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**2: How big is codon_dict ?**"
+    "**2: codon_dict isimli sözlüğün büyüklügü ne kadardır ?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**3: What does the 'GAT' codon encode?**"
+    "**3: 'GAT' kodonu ne kodlamaktadır?**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**4: Add one stop codon to codon_dict with value: '*'.**"
+    "**4: Bir tane stop kodonunu codon_dict isimli sözlüğe gösterilen şekilde ekleyiniz:'*'.**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**5: Change value of your stop codon to 'Q'.**"
+    "**5: Stop kodonu 'Q' olacak şekilde degiştiriniz.**"
    ]
   },
   {
    "cell_type": "markdown",
    "metadata": {},
    "source": [
-    "**6: Check if your stop codon is equal to Q.**"
+    "**6: Stop kodonunun Q 'ya eşit olup olmadığını kontrol ediniz.**"
    ]
   }
  ],