DrugGPT presents a ligand design strategy based on the autoregressive model, GPT, focusing on chemical space exploration and the discovery of ligands for specific proteins. Deep learning language models have shown significant potential in various domains including protein design and biomedical text analysis, providing strong support for the proposition of DrugGPT.
In this study, we employ the DrugGPT model to learn a substantial amount of protein-ligand binding data, aiming to discover novel molecules that can bind with specific proteins. This strategy not only significantly improves the efficiency of ligand design but also offers a swift and effective avenue for the drug development process, bringing new possibilities to the pharmaceutical domain
git clone https://github.com/LIYUESEN/druggpt.git
cd druggptOr you can just click Code>Download ZIP to download this repo.
conda create -n druggpt python=3.7
conda activate druggptpip install torch torchvision torchaudio --index-url https://download.pytorch.org/whl/cu117
pip install datasets transformers scipy scikit-learn
conda install -c openbabel openbabelRequired parameters:
-
-p|--pro_seq: Input a protein amino acid sequence. -
-f|--fasta: Input a FASTA file.Only one of -p and -f should be specified.
-
-l|--ligand_prompt: Input a ligand prompt. -
-e|--empty_input: Enable directly generate mode. -
-n|--number: At least how many molecules will be generated. -
-d|--device: Hardware device to use. Default is 'cuda'. -
-o|--output: Output directory for generated molecules. Default is './ligand_output/'. -
-b|--batch_size: How many molecules will be generated per batch. Try to reduce this value if you have low RAM. Default is 32. -
--top_k: The number of highest probability tokens to consider for top-k sampling. Defaults to 5. -
--top_p: The cumulative probability threshold (0.0 - 1.0) for top-p (nucleus) sampling. It defines the minimum subset of tokens to consider for random sampling. Defaults to 0.6.
-
If you want to input a protein FASTA file
python drug_generator.py -f bcl2.fasta -n 50
-
If you want to input the amino acid sequence of the protein
python drug_generator.py -p MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH -n 50
-
If you want to provide a prompt for the ligand
python drug_generator.py -f bcl2.fasta -l COc1ccc(cc1)C(=O) -n 50
-
Note: If you are running in a Linux environment, you need to enclose the ligand's prompt with single quotes ('').
python drug_generator.py -f bcl2.fasta -l 'COc1ccc(cc1)C(=O)' -n 50
DrugGPT: A GPT-based Strategy for Designing Potential Ligands Targeting Specific Proteins
Yuesen Li, Chengyi Gao, Xin Song, Xiangyu Wang, Yungang Xu, Suxia Han
bioRxiv 2023.06.29.543848; doi: https://doi.org/10.1101/2023.06.29.543848