NLPPrecursor is a deep learning framework that analyses protein sequences and predicts their RiPP biosynthetic family along with a possible cleavage site allowing for the rapid discovery of RiPPs in genomic data. NLPPrecursor fits best with a tool such as PRODIGAL, but any ORF finder should suffice.
NLPPrecursor is freely available for use on the DeepRiPP website: http://deepripp.magarveylab.ca. The following repository demonstrates how to use NLPPrecursor in a programatic manner on your own hardware. Caution, this does require you to be comfortable with Python!
NLPPrecursor works with python 3.7+ and needs two main requirements: PyTorch and FastAI.
Install pytorch according to your GPU/CPU preference here: https://pytorch.org
The project is not currently being developed, thus maintaining the installation process can be tricky given the number of dependencies. Fastai used to use the nightly release of pytorch and torchvision, but these are no longer compatible. A branch that is compatible with this library has been forked, which will need to be installed.
Conda is highly recommended, create a new environment specifically for NLPPrecursor for the easiest build. For example, here is one way to set this up:
conda create --name deepripp python=3.7
conda activate deepripp
pip install git+https://github.com/nishanthmerwin/fastai.git@deepripp_install
pip install git+https://github.com/magarveylab/nlpprecursorCurrent models are available through our releases.
To use them in your analysis, use the following code:
from nlpprecursor.classification.data import DatasetGenerator as CDG
from nlpprecursor.annotation.data import DatasetGenerator as ADG
from pathlib import Path
import nlpprecursor
import sys
# This allows for backwards compatibility of the pickled models.
sys.modules["protai"] = nlpprecursor
models_dir = Path("../models") # downloaded from releases!
class_model_dir = models_dir / "classification"
class_model_path = class_model_dir / "model.p"
class_vocab_path = class_model_dir / "vocab.pkl"
annot_model_dir = models_dir / "annotation"
annot_model_path = annot_model_dir / "model.p"
annot_vocab_path = annot_model_dir / "vocab.pkl"
sequences = [
{
"sequence": "MTYERPTLSKAGGFRKTTGLAGGTAKDLLGGHQLI",
"name": "unique_name",
}
]
class_predictions = CDG.predict(class_model_path, class_vocab_path, sequences)
cleavage_predictions = ADG.predict(annot_model_path, annot_vocab_path, sequences)
import json
print("Class predictions")
print(json.dumps(class_predictions, indent=4))
print("Cleavage predictions")
print(json.dumps(cleavage_predictions, indent=4))Output:
Class predictions
[
{
"class_predictions": [
{
"class": "LASSO_PEPTIDE",
"score": 0.9999966621398926
}
],
"name": "unique_name"
}
]
Cleavage predictions
[
{
"name": "unique_name",
"cleavage_prediction": {
"sequence": "LAGGTAKDLLGGHQLI",
"start": 19,
"stop": 35,
"score": -19735.994140625,
"name": "unique_name",
"status": "success"
}
}
]All training data to build the above models is available through this repo under training_data. Training
largely happens in two steps, first the classification model and second the cleavage (also called annotation) model.
In both cases, the training data is randomly stratified into training, validation and test data. During training, you will see up to date stats based on the validation set loss. And at the end, the model will be evaluated against the test data set and results will be output into the data_path directory.
The cleavage model is simple to train, and usually takes ~8 hours on a 4 core computer, 8gb of RAM and a K80 NVidia GPU.
from nlpprecursor.classification.data import DatasetGenerator
from pathlib import Path
import json
def train_opt(lm_json, class_json, data_path):
dg = DatasetGenerator(0.9, lm_json, class_json, data_path, bs=2)
print(dg.stage)
dg._read_jsons()
dg.stage += 1
print(dg.stage)
dg.tokenize()
dg.stage += 1
print(dg.stage)
dg.split_class_data()
dg.stage += 1
print(dg.stage)
dg.train_lm(epochs=1)
dg.stage +=1
print(dg.stage)
dg.train_class(epochs=1)
dg.test_class()
if __name__ == "__main__":
data_path = Path("./training_data/classification")
lm_json = data_path / "lm_data.json"
class_json = data_path / "class_data.json"
train_opt(lm_json, class_json, data_path)To train the cleavage model, use the following logic to input any train or update the models.
from nlpprecursor.annotation.data import DatasetGenerator
import pickle
import json
def train(data_path, json_path):
# Train split percent
# Training data path
# Save directory
# Batch size
dg = DatasetGenerator(0.9, json_path, data_path, bs=5)
dg.run(1) # Number of epochs
def test(data_path, raw_data_path):
data_path = Path(data_path)
model_path = data_path / "model.p"
vocab_path = data_path / "vocab.pkl"
datasplit_path = data_path / "datasplit.json"
results = DatasetGenerator.evaluate_later(model_path, vocab_path, datasplit_path, raw_data_path)
outpath = Path(data_path) / "tested.json"
with outpath.open("w") as fp:
json.dump(results, fp)
def predict(data_path, sequences):
data_path = Path(data_path)
model_path = data_path / "model.p"
vocab_path = data_path / "vocab.pkl"
if __name__ == "__main__":
data_path = "./training_data/annotation"
json_path = data_path + "/all_props.json"
train(data_path, json_path)
test(data_path, json_path)